PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG030897.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB
Protein Properties Length: 377aa    MW: 41773.9 Da    PI: 5.8069
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG030897.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd + +  v ++G+g+W++++++ g+ R++k+c++rw +yl
      CCG030897.1 14 RGLWTAEEDAKMLAHVSKHGTGNWTAVPKKAGLQRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding43.48e-1469109345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++T++E+e ++++++  G++ W+ Ia+ ++ gRt++++k++w+
      CCG030897.1  69 SFTPQEEEMIIRLHAAIGSR-WSIIAQQLP-GRTDNDVKNYWN 109
                      79******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-24564IPR009057Homeodomain-like
PROSITE profilePS5129423.538965IPR017930Myb domain
SuperFamilySSF466892.47E-3011108IPR009057Homeodomain-like
SMARTSM007173.2E-121363IPR001005SANT/Myb domain
PfamPF002497.5E-151461IPR001005SANT/Myb domain
CDDcd001674.56E-111761No hitNo description
Gene3DG3DSA:1.10.10.607.8E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129417.43966116IPR017930Myb domain
SMARTSM007171.2E-1266114IPR001005SANT/Myb domain
PfamPF002491.3E-1269109IPR001005SANT/Myb domain
CDDcd001678.03E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MVRPPCCDRL NVKRGLWTAE EDAKMLAHVS KHGTGNWTAV PKKAGLQRCG KSCRLRWTNY  60
LRPDLKHDSF TPQEEEMIIR LHAAIGSRWS IIAQQLPGRT DNDVKNYWNA RIRKKLSEMG  120
IDPVTHKPFS KILADYGNIG GIVKSGSRIG SLSRGLKNVF TLKPEQYPVT PEGMSNINSH  180
LMTTTVPPKT EPNQECFLNI KYNNNANDNH SLDLLDQLQA IRVVTEASST CTAYQTIPAP  240
CILDEGSLSS SSSSTCSTAA QEKFPTSFSW CDFLLEDEYL PGDHPHAEQE NAAEFSSKDL  300
TNQTQNPNVM IPQSAQSNTE VGAGVNGMDL ALQSNTGSDD QVALSSPQHS SFVETMMDGE  360
SKIFLDFPNL LEEISYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011042628.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLB9I3280.0B9I328_POPTR; Putative MYB transcription factor family protein
STRINGPOPTR_0012s07450.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.17e-74MYB family protein